PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G423300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 343aa    MW: 37289.6 Da    PI: 5.0258
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G423300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.7e-192572148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT eEd llv++v+ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Sobic.002G423300.1.p 25 RGPWTVEEDMLLVNYVAAHGEGRWNALARCAGLRRTGKSCRLRWLNYL 72
                          89********************************************97 PP

2Myb_DNA-binding50.64.3e-1678121146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sobic.002G423300.1.p  78 RGNITAQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 121
                           7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1592072IPR017930Myb domain
SuperFamilySSF466892.51E-3123119IPR009057Homeodomain-like
SMARTSM007173.5E-162474IPR001005SANT/Myb domain
PfamPF002494.4E-172572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-232679IPR009057Homeodomain-like
CDDcd001675.47E-132772No hitNo description
PROSITE profilePS5129423.12573127IPR017930Myb domain
SMARTSM007171.2E-1477125IPR001005SANT/Myb domain
PfamPF002497.7E-1578121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2280125IPR009057Homeodomain-like
CDDcd001671.45E-1182121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MAARDRRELS SDEESAAAAA GDLRRGPWTV EEDMLLVNYV AAHGEGRWNA LARCAGLRRT  60
GKSCRLRWLN YLRPDLRRGN ITAQEQLLIL ELHSRWGNRW SKIAQHLPGR TDNEIKNYWR  120
TRVQKHARQL NCDVNSQQFK DLMRYIWMPR LLERIGSDDS GDGAVVIDAA VHADATPSPT  180
PTLQPQPQPL LTAAAWPVDD VELSCTTAVS SSSVSTDSMH HHQQLAAVSP PPPPPPAVAS  240
AAFGESNNDG SYYGIDNSNT AMSMWDTLCQ PPHSTTAQLA GAGTCGWSDE SLLVVPSGLL  300
GDGGVYADMG FPDLCDTDTM TMWAAGAGSS ADDLWYTQTM GL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-25221251103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4741320.0AF474132.1 Sorghum bicolor typical P-type R2R3 Myb protein (Myb63) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008667098.11e-168PREDICTED: putative MYB DNA-binding domain superfamily protein isoform X1
TrEMBLB4FBZ61e-162B4FBZ6_MAIZE; Uncharacterized protein
TrEMBLK4JFE41e-162K4JFE4_MAIZE; MYB-type transcription factor (Fragment)
STRINGGRMZM2G176327_P011e-162(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-76myb domain protein 112